PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10026142
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 1218aa    MW: 133718 Da    PI: 5.8804
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10026142genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.51.1e-16551598148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+ Ed +l+++vk+ G g+W+++ ++ g+ R++k+c++rw ++l
      Lus10026142 551 KGPWTAAEDAILIEYVKKNGEGNWNAVQKHSGLSRCGKSCRLRWANHL 598
                      79******************************************9986 PP

2Myb_DNA-binding52.61.1e-16604647146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T+eE++l++++++++G++ W++ a++++ gRt++++k++w++
      Lus10026142 604 KGAFTQEEEQLIIELHAKMGNK-WARMAAHLP-GRTDNEIKNYWNT 647
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF057938.8E-11247517IPR008851Transcription initiation factor IIF, alpha subunit
Gene3DG3DSA:1.20.1130.104.4E-852105IPR001280Photosystem I PsaA/PsaB
SuperFamilySSF509163.14E-3052182IPR011039Transcription Factor IIF, Rap30/Rap74, interaction
SuperFamilySSF467852.99E-5471511IPR011991Winged helix-turn-helix DNA-binding domain
Gene3DG3DSA:1.10.10.104.9E-6474510IPR011991Winged helix-turn-helix DNA-binding domain
PROSITE profilePS5129417.476546598IPR017930Myb domain
SuperFamilySSF466892.07E-30548645IPR009057Homeodomain-like
SMARTSM007171.2E-15550600IPR001005SANT/Myb domain
PfamPF002494.2E-15551598IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-23552605IPR009057Homeodomain-like
CDDcd001675.82E-11553598No hitNo description
PROSITE profilePS5129426.807599653IPR017930Myb domain
SMARTSM007172.3E-17603651IPR001005SANT/Myb domain
PfamPF002491.1E-15604647IPR001005SANT/Myb domain
CDDcd001674.93E-12606647No hitNo description
Gene3DG3DSA:1.10.10.602.6E-26606653IPR009057Homeodomain-like
PfamPF139667.9E-910831149IPR026960Reverse transcriptase zinc-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006367Biological Processtranscription initiation from RNA polymerase II promoter
GO:0009723Biological Processresponse to ethylene
GO:0009751Biological Processresponse to salicylic acid
GO:0015979Biological Processphotosynthesis
GO:0032968Biological Processpositive regulation of transcription elongation from RNA polymerase II promoter
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0005634Cellular Componentnucleus
GO:0009522Cellular Componentphotosystem I
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0003824Molecular Functioncatalytic activity
Sequence ? help Back to Top
Protein Sequence    Length: 1218 aa     Download sequence    Send to blast
MTIDLVLKPS CRCGSTSNLY GSNCKHMTLC LDCGKKMAET GAKCYDCGAP VTRLIREYNV  60
RATPSSDKNY FIGRFMGGLP SFSKKKSAEN KWSIHKEGLQ GRMLSENLRE RYKNKPWLLE  120
DETGQHRFHG QMEGSQSVTY YLLMVQGKEF AAIPAGSWYN FNKVAQYKQL TLEEAEEKMK  180
NRRKTAEGYE RWMMKAAADG PAAFGVKDSL DDADAGTGGT RGRKKASGDN DEGNVSDKGE  240
EDEDDEASRK SRLGLAKRGG DDDEEGKRGG DHDDDDDIEK GDDWEHEEIF TDDDEAVGSD  300
HELPEELAPA PPEIKQDDED EDEENEEGKL SSSGKELKKL LGKAAGLSDS DGEDDDDDDA  360
EDEISPVLTP KKKEAVKEEP SDNNTPSKTT AAGSTKGNAT TSKSGKEKRK ADDFKASNSA  420
TPKKAKAEES NLKKVKTEVE SKPSVKEEVT PNSKGNSSSK VAPPPAKASS APASGPVTEE  480
EIKAVLLEGG PITTQELVGR FKSRLKCSEK KMSHMTNESK DCFLPNEQIE SPLADEGNSS  540
RKGNGETNLK KGPWTAAEDA ILIEYVKKNG EGNWNAVQKH SGLSRCGKSC RLRWANHLRP  600
NLKKGAFTQE EEQLIIELHA KMGNKWARMA AHLPGRTDNE IKNYWNTRIK RRLRAGLPLY  660
PPDLSSQSYR DNQWDQNIGA MNCGRKGHHE LLHNCHQIPD ATFDSLKASQ IRVSNSLLEL  720
ADINSSQMMI KGQGSSQYGS FISPVMHSKK RLRESTSQLS GFSVSGRNDF SLFSFQNDLR  780
EKATQSFGLS YPFVSDPNTK IQHRHGVGDD DQNGHTQSYG IFSASKPNSG AVKLELPSLQ  840
YTENDASSCW GISSPPPLLE SYDNFIQSLP TSTVGSSYLS PRNSGLLDAL LHEAKTLSTA  900
KKHSSEKSSN SSTVTPGDIA DSLSPNGHDP EWDNYGNPLS PTATSYFSKR STPISASGSS  960
LDEQPPIETF TGCDIKTEAL TPERERDAIT RRPDALLDSD WLEQGSGSSY VKDQVVMTDA  1020
IAALLGDDLS SEYKQMAGAG TSSGASQGWV LGSCAWNNMP PSHVKSVIVT VDWDSLRAKH  1080
AHVGWCDLIR RGPCIPKHCF VAWLAVHKRL VTHSMMVSWG LSLDICCFLC SHGADELTHL  1140
MVDCDFEKTV RNFCLGRDDT LFLDWTDFVV HHCRAFAGGA SACSGQLFSR AIMSEIPLPP  1200
SREIAARICR DIAFVVR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-315456531108B-MYB
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1647653RIKRRLR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00348DAPTransfer from AT3G11440Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11440.11e-110myb domain protein 65